It is currently unclear whether the genome sequence annotated as ORF10 that is predicted to be located downstream of the nucleocapsid gene translates into a functional protein in SARS-CoV-2. Instead may act, itself or as a precursor of other RNAs, in the regulation of gene expression, replication, or modulating cellular antiviral pathways. The respective region in related beta-coronaviruses, such as SARS-CoV, does not correspond to the translated peptide.

MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT

38 aa; 150 kDa