World Wide Mutant

Summary Mutant for Explorer

Information about envelope

Description

The envelope (E) protein is the smallest amongst all the structural proteins and plays a major role in pathogenesis, virus morphogenesis and assembly, and release. Acts as a viroporin and self-assembles in host membranes forming pentameric protein-lipid pores that allow ion transport. Also plays a role in the induction of apoptosis. Activates the host NLRP3 inflammasome, leading to IL-1beta overproduction.

Sequence

MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV

Length and Mass

75 aa; 150 kDa

Pie chart

Heat chart