World Wide Mutant

Summary Mutant for Explorer

Information about nsp6

Description

The NSP6 together with NSP3 and NSP4 redirect and rearrange host cell membranes as part of the viral genome replication and transcription machinery and induce the formation of double-membrane vesicles (DMVs). The NSP6 locates in the endoplasmic reticulum (ER) and plays a role in the initial induction of autophagosomes from the host reticulum endoplasmic which are responsible for the delivery of cytoplasmic contents to lysosomes. In addition to initiating autophagosome formation, NSP6 also limits the expansion of these phagosomes that are no longer able to deliver viral components to lysosomes. This may favor SARS-CoV-2 infection by compromising the ability of autophagosomes to deliver viral components to lysosomes for degradation

Sequence

SAVKRTIKGTHHWLLLTILTSLLVLVQSTQWSLFFFLYENAFLPFAMGIIAMSAFAMMFVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRIMTWLDMVDTSLSGFKLKDCVMYASAVVLLILMTARTVYDDGARRVWTLMNVLTLVYKVYYGNALDQAISMWALIISVTSNYSGVVTTVMFLARGIVFMCVEYCPIFFITGNTLQCIMLVYCFLGYFCTCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKNSIDAFKLNIKLLGVGGKPCIKVATVQ

Length and Mass

290 aa; 150 kDa

Pie chart

Heat chart