World Wide Mutant

Summary Mutant for Explorer

Information about orf6

Description

The ORF6 protein disrupts cell nuclear import complex formation via tethering the nuclear import factors Kap?2 and Kap?1 to the ER/Golgi membrane. Retention of import factors at the ER/Golgi membrane, effectively blocking STAT1 transport into the nucleus in response to interferon signaling. Thus, the virion blocked the expression of interferon stimulated genes (ISGs) involved in the multiple antiviral innate immune response.

Sequence

MFHLVDFQVTIAEILLIIMRTFKVSIWNLDYIINLIIKNLSKSLTENKYSQLDEEQPMEID

Length and Mass

61 aa; 150 kDa

Pie chart