World Wide Mutant

Summary Mutant for Explorer

Information about orf7a

Description

Expression studies suggested that ORF7a protein which is dispensable for virus replication in cell culture may be involved in virus-host interactions include induction of apoptosis through a caspase-dependent pathway, activation of the p38 mitogen-activated protein kinase signaling pathway, inhibition of host protein translation, and suppression of cell growth progression.

Sequence

MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE

Length and Mass

121 aa; 150 kDa

Pie chart