World Wide Mutant

Summary Mutant for Explorer

Information about orf9b

Description

he accessory protein orf9b is present in both SARS-CoV-2 and SARS-CoV. This 98-amino acid (aa) protein is encoded by an alternative open reading frame (ORF) within the N gene and is translated via a leaky scanning mechanism during translation

Sequence

MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKTLNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK

Length and Mass

97 aa; 150 kDa

Pie chart

Heat chart